PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000193056
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 289aa    MW: 32701.6 Da    PI: 4.9128
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000193056genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding64.81.6e-203783248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g+WT+eEd +l+d+v+++G g+W++ ar+ g++Rt+k+c++rw++yl
    MDP0000193056 37 GPWTAEEDSILIDYVNLHGEGRWNSLARHAGLKRTGKSCRLRWLNYL 83
                     89*******************************************97 PP

2Myb_DNA-binding408.9e-1389132146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T +E+++++ ++  +G++ W++Ia+ ++ gRt++++k++w++
    MDP0000193056  89 RGNITLQEQLIILXLHSCWGNR-WSKIAEXLP-GRTDNEIKNYWRT 132
                      7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.7443187IPR017930Myb domain
SuperFamilySSF466897.03E-3033130IPR009057Homeodomain-like
SMARTSM007177.9E-173585IPR001005SANT/Myb domain
PfamPF002491.8E-183683IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.3E-243790IPR009057Homeodomain-like
CDDcd001675.41E-143883No hitNo description
PROSITE profilePS5129416.2688138IPR017930Myb domain
SMARTSM007171.3E-1088136IPR001005SANT/Myb domain
PfamPF002492.7E-1189132IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-2091137IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MDTSNVHDQM KSAGYGSLAA AAAPDQPIEE GLGLRTGPWT AEEDSILIDY VNLHGEGRWN  60
SLARHAGLKR TGKSCRLRWL NYLRPSVRRG NITLQEQLII LXLHSCWGNR WSKIAEXLPG  120
RTDNEIKNYW RTRVQKQAKQ LKCDVNSKQF QDAMRYVWIP RXIERIGGLP ESLPDQPRTC  180
TTTXSEXEYW VDTNFVPKTS GXTSSDSYDQ VQACSIPTDR TSSGDEFMTY PCSGQYGSEN  240
GSGYSQNGIN SDIHDFEQID YCSTGGDTSV ENLWNEENIW FLQQQLSDG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25341385108B-MYB
1h8a_C3e-253413825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008348686.10.0PREDICTED: transcription factor MYB108-like
TrEMBLM5XUE41e-132M5XUE4_PRUPE; Uncharacterized protein
STRINGPOPTR_0002s19250.12e-88(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87534125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47190.12e-74myb domain protein 2